PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PSME_00024681-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga
Family bZIP
Protein Properties Length: 74aa    MW: 8912.22 Da    PI: 10.6162
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PSME_00024681-RAgenomePRSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_122.91.9e-072351144
                      HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
            bZIP_1 11 qkNReAArrsRqRKkaeieeLeekvkeLeaeNka 44
                       +NRe+A+ s +RK++ ++eL+  +  L a+N++
  PSME_00024681-RA  2 FSNRESAKSSQLRKQQHLDELRAQMVHLMAKNEE 35
                      69******************************84 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF579591.24E-5134No hitNo description
Gene3DG3DSA:1.20.5.1701.2E-4336No hitNo description
Sequence ? help Back to Top
Protein Sequence    Length: 74 aa     Download sequence    Send to blast
MFSNRESAKS SQLRKQQHLD ELRAQMVHLM AKNEESVKRT QIQKQQHLDE LRAHMVHLMV  60
ENKEYAKRSQ LQKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75390.13e-09basic leucine-zipper 44